This is a working overview of NMN, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-05-15. Anything still debated is marked as such rather than presented as settled.
Research on NMN has focused on aging, metabolic regulation, exercise capacity, and insulin sensitivity, but findings are preliminary. Many human trials are small, short in duration, and use different endpoints, which complicates comparison across studies. No national regulator has approved NMN as a therapeutic drug for any indication. In some countries it is sold as a supplement or research chemical, while other jurisdictions have questioned its status under food or supplement laws. Claims about extending human lifespan or reversing aging are not supported by established clinical evidence.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide found in the cells of many organisms, including bacteria, plants, and mammals. Its structure consists of a nicotinamide ring attached to a ribose-phosphate group. NMN functions as an intermediate in the NAD+ salvage pathway, a recycling route that regenerates nicotinamide adenine dinucleotide. The enzyme nicotinamide phosphoribosyltransferase produces NMN from nicotinamide and phosphoribosyl pyrophosphate. A second enzyme, NMN adenylyltransferase, then converts NMN into NAD+.
Dietary sources of NMN include small amounts in certain vegetables, fruits, and other foods, although exact values vary by sample and method. Endogenous NMN concentrations are tightly regulated and often low, making measurement in blood or tissues technically demanding. After oral intake, NMN is thought to be rapidly metabolized in the intestine and liver, and intact NMN may not reach all tissues at high levels. Some rodent studies report increases in tissue NAD+ after oral NMN, while human data remain limited and sometimes rely on blood NAD+ metabolites rather than direct tissue measures.
Research on NMN includes cell studies, animal experiments, and a growing number of human trials. Many early findings come from mice, where changes in NAD+ levels and metabolic markers have been reported. Human data are more limited, and questions remain about effective routes of administration, tissue distribution, and long-term effects. Some trials measure NAD+ in blood or tissue, while others assess physical function or metabolic outcomes. Regulatory status differs between countries, and NMN is not universally approved as a dietary supplement or therapeutic agent.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide ring with a ribose sugar and a phosphate group. The compound appears in cells across many organisms as an intermediate in the production of nicotinamide adenine dinucleotide, or NAD+. Because NMN sits close to NAD+ in metabolism, it has drawn interest in biochemistry and aging research. The molecule is not a dietary essential nutrient in the classical sense, and its presence in food is generally low and variable.
NAD+ serves as a coenzyme in redox reactions and as a substrate for enzymes involved in DNA repair and cellular signaling. In the salvage pathway, nicotinamide is converted to NMN by the enzyme NAMPT. NMN is then converted to NAD+ by NMNAT enzymes. A separate route links nicotinamide riboside to NMN through phosphorylation. These pathways maintain NAD+ levels, which can decline with age or metabolic stress in some tissues. The relative contribution of circulating NMN to tissue NAD+ remains an active area of study.
| Property | Value | Notes |
|---|---|---|
| Chemical name | Nicotinamide mononucleotide | Nucleotide intermediate in NAD+ salvage pathway |
| Common abbreviation | NMN | Also written as β-NMN |
| Molecular formula | C11H15N2O8P | Uncharged parent form |
| Molar mass | 334.22 g/mol | Calculated from formula |
| CAS Registry Number | 1094-61-7 | For β-nicotinamide mononucleotide |
In the canonical salvage pathway, nicotinamide phosphoribosyltransferase, known as NAMPT, transfers a phosphoribosyl group to nicotinamide and releases NMN. A second enzyme, NMN adenylyltransferase, then attaches an adenylyl group to NMN to form NAD+. Alternative routes exist, including a pathway that uses nicotinamide riboside and its phosphorylated forms. The relative contribution of extracellular NMN to intracellular NAD+ pools remains an area of active investigation, and the roles of specific transporters and enzymes are not completely defined.
NMN is present in small amounts in various foods, including certain vegetables, fruits, and milk, though dietary quantities are generally low. Laboratory research often uses synthetic or enzymatically produced NMN. The compound has drawn interest because NAD+ levels decline with age in some tissues and because restoring NAD+ may affect metabolism in animal models. Whether oral NMN produces meaningful NAD+ increases in humans and whether such changes translate into health benefits are not fully established.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide base with a ribose sugar and a phosphate group. Within cells, NMN sits on the biosynthetic route that recycles nicotinamide back into nicotinamide adenine dinucleotide, or NAD+. Because NAD+ participates in redox reactions and signaling, enzymes that produce and consume it influence many metabolic processes. The compound is therefore best described as an intermediate rather than a final signaling molecule.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide found in cells. Its structure combines a nicotinamide ring, a ribose sugar, and a phosphate group. As an intermediate in the NAD+ salvage pathway, NMN is converted to nicotinamide adenine dinucleotide, a coenzyme central to cellular redox reactions. NAD+ also serves as a substrate for enzymes involved in DNA repair, stress responses, and metabolic regulation. The compound is therefore part of normal cellular biochemistry rather than an exclusively synthetic molecule.
Two enzymatic steps define the canonical route from nicotinamide to NAD+. Nicotinamide phosphoribosyltransferase, known as NAMPT, produces NMN from nicotinamide and phosphoribosyl pyrophosphate. NMN adenylyltransferases, or NMNAT enzymes, then couple NMN with ATP to form NAD+. Whether intact NMN crosses cell membranes efficiently remains an active area of investigation; some studies propose direct transport, while others emphasize extracellular dephosphorylation to nicotinamide riboside followed by uptake. The relative contribution of each route likely depends on cell type, tissue, and experimental conditions.
Nicotinamide mononucleotide, abbreviated NMN, is a nucleotide composed of nicotinamide, ribose, and phosphate. Its structure links nicotinamide to D-ribose 5-phosphate through a glycosidic bond, placing it in the pyridine nucleotide family. The compound exists in alpha and beta anomeric forms, and the beta form is the one used in NAD+ biosynthesis. NMN is not a protein or a hormone; it is a small water-soluble molecule that occurs in living cells as a metabolic intermediate.
Natural sources of NMN include mammals, plants, and microorganisms, where it functions as an intermediate in NAD+ salvage and biosynthesis pathways. In mammals, the enzyme nicotinamide phosphoribosyltransferase produces NMN from nicotinamide and phosphoribosyl pyrophosphate. NMN is then converted to NAD+ by nicotinamide mononucleotide adenylyltransferase. Some foods contain measurable NMN, but reported amounts vary widely by species, tissue, and analytical method. The extent to which dietary NMN contributes to cellular NAD+ pools remains an open research question.
Chemically, NMN is described by the molecular formula C11H15N2O8P and a molecular mass near 334.22 g/mol. The beta anomer has a CAS Registry Number of 1094-61-7. It is typically supplied as a white to off-white powder for laboratory use. The molecule carries a phosphate group and a positively charged nicotinamide ring, giving it polar and water-soluble character. These properties influence how it is detected, purified, and stored in research and analytical laboratories.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide ring, a ribose sugar, and a phosphate group. The compound exists in cells as an intermediate in the production of nicotinamide adenine dinucleotide, a central redox cofactor. NMN is distinct from nicotinamide riboside, another related pyridine nucleotide, although the two compounds can converge in metabolic pathways. Its chemical formula is C11H15N2O8P, and it carries a net negative charge at physiological pH.
In the salvage pathway, NMN is generated from nicotinamide and 5-phosphoribosyl-1-pyrophosphate by the enzyme nicotinamide phosphoribosyltransferase. A second route produces NMN from nicotinamide riboside through phosphorylation by nicotinamide riboside kinases. NMN is then converted to NAD+ by nicotinamide mononucleotide adenylyltransferases, often called NMNAT enzymes. This stepwise route allows cells to recycle nicotinamide and maintain NAD+ levels under changing metabolic conditions. The relative contribution of each route varies by tissue, species, and physiological state, and it remains an active area of research.
== Role in disease == A defect in the degradation of glucocerebrosides is Gaucher's disease. The corresponding defects for galactocerebrosides are: a) Ceramide trihexoside (globotriaosylceramide) accumulation – Fabry's disease. Clinical features include acroparaesthesia (tingling, pins and needles sensation in the extremities) b) Galactocerebroside (galactosylceramidase) accumulation – Krabbe disease.
=== Oxygen and small molecule dependent degrons === The presence of oxygen or other small molecules can influence degron recognition. The von Hippel-Lindau (VHL) protein (substrate recognition part of a specific E3 ligase), for instance, recognizes the hypoxia-inducible factor alpha (HIF-α) only under normal oxygen conditions, when its proline is hydroxylated. Under hypoxia, on the other hand, HIF-a is not hydroxylated, evades ubiquitination and thus operates in the cell at higher concentrations which can initiate transcriptional response to hypoxia. Another example of small molecule control of protein degradation is phytohormone auxin in plants. Auxin binds to TIR1 (the substrate recognition domain of SCFTIR1ubiquitin ligase) increasing the affinity of TIR1 for its substrates (transcriptional repressors: Aux/IAA), and promoting their degradation.
. This Laplacian term can be interpreted as the difference between the velocity at a point and the mean velocity in a small surrounding volume. This implies that – for a Newtonian fluid – viscosity operates as a diffusion of momentum, in much the same way as the heat conduction. In fact neglecting the convection term, incompressible Navier–Stokes equations lead to a vector diffusion equation (namely Stokes equations), but in general the convection term is present, so incompressible Navier–Stokes equations belong to the class of convection–diffusion equations. In the usual case of an external field being a conservative field:
=== Leaves === The leaf outline is mostly ovate to rhomboid. The outline can sometimes be elliptic or obovate. The leaf margin is dentate or deeply lobed. The indumentum of the leaves can vary. There is often a hairy upper surface, and the lower surface can be sparsely to densely hairy. It has been described as feeling velvety. When the leaves are crushed, there is an unpleasant scent. This may be due to the pelate hairs or pelate glands on the leaves. The leaves are opposite whorls of 3–4. The petiole is 0–24 mm long.
Since irregularities in the menstrual cycle are normal shortly after menarche and during perimenopause, the age of the individual and the time since menarche need to be taken into account. Menstrual cycles are considered irregular in the following cases:
Sources: en.wikipedia.org
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
==== Stability ==== A disadvantage of using nanocrystals for drug delivery is nanocrystal stability. Instability problems of nanocrystalline structures derive from thermodynamic processes such as particle aggregation, amorphization, and bulk crystallization. Particles at the nanoscopic scale feature a relative excess of Gibbs free energy, due to their higher surface area to volume ratio. To reduce this excess energy, it is generally favorable for aggregation to occur. Thus, individual nanocrystals are relatively unstable by themselves and will generally aggregate. This is particularly problematic in top-down production of nanocrystals. Methods such as high-pressure homogenization and bead milling, tend to increase instabilities by increasing surface areas; to compensate, or as a response to high pressure, individual particles may aggregate or turn amorphous in structure. Such methods can also lead to the reprecipitation of the drug by surpassing the solubility beyond the saturation point (Ostwald ripening). One method to overcome aggregation and retain or increase nanocrystal stability is by use of stabilizer molecules. These molecules, which interact with the surface of the nanocrystals and prevent aggregation via ionic repulsion or steric barriers between the individual nanocrystals, include surfactants and are generally useful for stabilizing suspensions of nanocrystals. Concentrations of surfactants that are too high, however, may inhibit nanocrystal stability and enhance crystal growth or aggregation.
Anaerobic growth: Positive Voges Proskauer test: Positive Acid produced from D-glucose: Positive L-arabinose: Negative D-xylose: Negative D-mannitol: Negative Starch hydrolysis: Positive Nitrate reduction: Positive Degradation of tyrosine: Positive Growth at above 50 °C: Negative Use of citrate: Positive The Central Public Health Laboratory in the United Kingdom tests for motility, hemolysis, rhizoid growth, susceptibility to γ-phage, and fermentation of ammonium salt-based glucose but no mannitol, arabinose, or xylose.
In March 2023, Collins collaborated with Seventy Hyal 2000 to promote their skin boosting product, in which she appeared in a series of online advertisement campaigns as well as on a billboard alongside a phone number, encouraging consumers to call "The Hydration Hotline". In April 2024, Collins collaborated with the cosmetics brand e.l.f., during which she rode a rollercoaster whilst applying the brand's SKIN Bronzing Drops in a video promoting the product. In October 2024, Collins partnered with Superdrug and was appointed "The Beauty Boss" in a campaign promoting the store's seasonal offering and in-store beauty services. Of the collaboration, Collins said she was "so excited about the partnership [...] because since [she was] a young girl [Superdrug] was her go-to place". As part of her role, Collins also fronted a YouTube mini-series in which she explored the companies' products and was joined by special guests including Chloe Sims, whom she had a conversation with whilst receiving beauty treatments. In February 2025, Collins collaborated with the sportswear brand TLC Sport to front their "Find Your Supermodel" campaign and launch a new collection of activewear. The brand subsequently put out a casting call for thirty women to join her for a photoshoot as part of the launch, in which they used no editing or airbrushing on the photos. Collins praised the brand as "inclusive" and encouraged consumers to "empower each other to be [their] best selves".
Sources: en.wikipedia.org
== Functions == Dense regular connective tissue has great tensile strength that resists pulling forces especially well in one direction. DRCT has a very poor blood supply, which is why damaged tendons and ligaments are slow to heal.
Adam Baldwin (born February 27, 1962) is an American actor. He made his film debut in My Bodyguard (1980) and later appeared in films including Full Metal Jacket (1987), Predator 2 (1990), Independence Day (1996), The Patriot (2000), and Serenity (2005). On television, he is known for playing Jayne Cobb in Firefly, John Casey in Chuck, and Mike Slattery in The Last Ship. He has also worked as a voice actor, including as Superman in Superman: Doomsday (2007) and Dutch in Halo 3: ODST (2009).
On 15 June, US vice president JD Vance announced that the memorandum was digitally signed by both countries the previous day. On 17 June, Trump and Iranian president Masoud Pezeshkian signed the Islamabad Memorandum to end the war, with Trump signing it during dinner with French president Emmanuel Macron at the Palace of Versailles after the G7 summit. On 18 June, Pakistan stated that the signing of the memorandum implies Tehran will reopen the Strait of Hormuz "instantly" and the American blockade will end "immediately." CENTCOM announced that it had removed the naval blockade. On 19 June, Trump announced a renewed ceasefire between Israel and Hezbollah in the 2026 Lebanon war, facilitated by the US, Qatar, and Iran. However, on 20 June, Hezbollah announced an attack on Israeli forces trying to capture Ali al-Taher in Nabatieh, while Israel continued to strike southern Lebanon.
Sources: en.wikipedia.org
NMN is nicotinamide mononucleotide, a nucleotide intermediate in the NAD+ salvage pathway. Cells use it to help regenerate NAD+, a coenzyme involved in energy metabolism and cellular signaling. It is present naturally in many organisms and is also produced synthetically for research and consumer products.
NMN is the immediate precursor to NAD+ in the salvage pathway. The enzyme NMN adenylyltransferase adds an adenylate group to NMN to form NAD+. Because NAD+ levels decline with age in some tissues, researchers study whether raising NMN availability can influence NAD+ metabolism.
No. Human evidence is limited, and no regulatory agency has approved NMN for treating or preventing aging. Some trials measure NAD+ metabolites or metabolic markers, but their results do not establish a clinical benefit. Larger, longer studies with standardized endpoints are needed.
NMN is a naturally occurring nucleotide and an intermediate in NAD+ biosynthesis. It consists of nicotinamide attached to a ribose phosphate unit. Cells produce it through the salvage pathway.